biotech report

profileA11113
fgenesh_getfile.pdf

FGENESH 2.6 Prediction of potential genes in Talaromyces genomic DNA Seq name: 42 Length of sequence: 20001 Number of predicted genes 8: in +chain 4, in -chain 4. Number of predicted exons 32: in +chain 12, in -chain 20. Positions of predicted genes and exons: Variant 1 from 1, Score:521.727344

CDSf CDSi CDSl CDSo PolA TSS

1 14 200 400 600 800 1000 1200 1400 1600 1800 2000 2310

1 2 3 4 5

1 - 1 CDSi 14 - 1048 33.27 14 - 1048 1035 1 - 2 CDSi 1118 - 1443 27.89 1118 - 1441 324 1 - 3 CDSi 1512 - 1591 4.39 1513 - 1590 78 1 - 4 CDSi 1655 - 1911 6.03 1657 - 1911 255 1 - 5 CDSf 2142 - 2189 1.08 2142 - 2189 48 1 - TSS 2310 -2.52

2 2766 3000 3200 3400 3600 3800 4000 4200 4406

1 2

2 + TSS 2766 -4.43 2 + 1 CDSf 2880 - 3439 38.16 2880 - 3437 558 2 + 2 CDSl 3513 - 4050 20.59 3514 - 4050 537 2 + PolA 4406 -2.92

3 4591 5000 5500 6000 6500 7000 7500 8000 8500 9000 9296

1 2 3 4 5 6 7

3 - PolA 4591 1.88 3 - 1 CDSl 5007 - 5140 7.86 5007 - 5138 132 3 - 2 CDSi 5204 - 6188 66.50 5205 - 6188 984 3 - 3 CDSi 6453 - 6546 0.94 6453 - 6545 93 3 - 4 CDSi 6897 - 7113 13.48 6899 - 7111 213 3 - 5 CDSi 7180 - 7640 23.34 7181 - 7639 459 3 - 6 CDSi 7711 - 8475 44.02 7713 - 8474 762 3 - 7 CDSf 8573 - 8805 5.80 8575 - 8805 231 3 - TSS 9296 -5.90

4 9468 10000 10500 11000 11500 11814

1 2 3 4 5

4 - PolA 9468 -4.02

Now Loading..
CDS = CoDing Sequence CDSf, CDSi, CDSl = coding sequence first, internal, and last, respectively. PolA = signal for PolyA tail TSS = transcription start site

4 - 1 CDSl 9547 - 9709 5.13 9547 - 9708 162 4 - 2 CDSi 9787 - 9962 1.61 9789 - 9962 174 4 - 3 CDSi 10051 - 10353 21.23 10051 - 10353 303 4 - 4 CDSi 10581 - 11375 28.12 10581 - 11375 795 4 - 5 CDSf 11452 - 11535 8.11 11452 - 11535 84 4 - TSS 11814 -7.23

5 12367 13000 13500 14000 14665

1 2 3 4 5

5 + TSS 12367 -4.23 5 + 1 CDSf 12442 - 12522 -2.36 12442 - 12522 81 5 + 2 CDSi 12586 - 13413 60.38 12586 - 13413 828 5 + 3 CDSi 13522 - 13836 26.45 13522 - 13836 315 5 + 4 CDSi 13929 - 14095 5.68 13929 - 14093 165 5 + 5 CDSl 14175 - 14331 1.79 14176 - 14331 156 5 + PolA 14665 1.88

6 14740 15000 15200 15400 15600 15800 16074

1 2 3

6 - PolA 14740 -4.02 6 - 1 CDSl 15265 - 15741 39.06 15265 - 15741 477 6 - 2 CDSi 15898 - 15921 0.01 15898 - 15921 24 6 - 3 CDSf 15986 - 16021 4.49 15986 - 16021 36 6 - TSS 16074 -5.93

7 16111 16500 17000 17500 18000 18689

1 2 3

7 + TSS 16111 0.18 7 + 1 CDSf 17133 - 17381 12.81 17133 - 17381 249 7 + 2 CDSi 17440 - 17690 31.31 17440 - 17688 249 7 + 3 CDSl 17775 - 17895 5.17 17776 - 17895 120 7 + PolA 18689 1.88

8 18813 19000 19200 19400 19600 19800 19993

1 2

8 + TSS 18813 -6.03 8 + 1 CDSf 19088 - 19396 43.11 19088 - 19396 309 8 + 2 CDSi 19460 - 19993 42.45 19460 - 19993 534

Predicted protein(s): >FGENESH:[mRNA] 1 5 exon (s) 14 - 2189 1746 bp, chain -

ATGCCGAACACCGTCTTCTCGTGTATGGTCTCAAGAAAGCTAGGATATCTCAATATCATG CTCTCGCTTAACACAGAACGGTCGAAGGGAACTACTGGCGATTCCTTAGAATTGACAGAT GTTCTGAAAAATGGCACACTATCAACACTGGCCAATGAGGATATCTGTGAAAAAAATGAC AGCTCTACTTCAGGATCACGAGAAACAGTTGGCCGAGCGAAAGATGACACAAATTACCCA AAGGGCGCGAAAATGTTTCTCATAGTGGTCTCTCTGTGTCTTGCAGTCTTCTTGATGGCT TTAGACAACTCGGTGATAACCACAGCGATTCCAAAAATCACTGATGACTTTGGTAGCGTG TTAGATGTAGGGTGGTACGGAAGTGCTTACTTGCTGACAACTGCCTCCCTGCAACTCATT TTCGGCAAGATTTACACATTTTGGAGCATCAAATTGGTTTTCTTATCGACCATCGCCGTA TTCGAGCTCGGTAGCTTAATATGCGCCGTCGCACCTTCATCAACGGCTTTTATCGTCGGA CGAGCAATTGCTGGATCTGGTTCTGCCGGTATATTTTCCGGTGCTCTGCTCATCATCACC CATACTTCTCCTCTGGCAAAACGACCAACATATATCGGTTTAGCGGGCGGTATGTATGGG ATAGCATCTGTGGCTGGTCCTATCATCGGAGGCGTCCTTACTGACAATGTGTCTTGGCGA TGGTGCTTTTATATAAATCTACCACTGGGCGGCGTTACGGCTCTGGCCATCTGGTTGATC CTCAAGGATCCGCAACGAGATGTGCCAACGCTTCAAACTTGGATGGATCGCATAAGAGTC TTGGATCCCATTGGGACCCTGATTTTCTTACCAGCAATGGTTTGCCTGTTGCTCACCCTA CAATGGGGAGGTTCGAAGTACAGCTGGAATGATGGGCGAATCATTGCTCTTCTGGTTCTT TCTGGCGTTCTGATCATAGCTTTTCTGCTTATCCAGCTTCGCCTACAAGAAGCTGCAACA GTGCCTCCGCGCATCTTTCGCAATCGTTCCGTGTGGGCTGGTTGCCTCTACGGGTTTTGT ACAAGTTCGGCATTTTTTCTTGTCATATACTACATCCCCATTTGGTTCCAGGCAATACAA GGAGTTTCAGCTATTGAATCCGGCATTCGAAACCTTCCAATGATGATTTCAACAATTCTC ATGTCTATAATGGTCGGCGGCCTGGTGACGGCTCTAGGATACTATACGCCGTTCATGATT GCGGCAGCAATTCTTTCCTCTGTCGGAGCAGGTCTTCTCTCTACTTTTGCAGTTCATACC TCAAGCGGGAAATGGATTGGTTATCAGATCCTGTTCGGCATCGGATACAGTCTCGGTTCA AGACAGCCTTTGGTGGCTGTTCAGGCAGCCCTAGAAACAAAGGACATACCTATTGGTACA TCTATCATTATGTTTCTGCAAACACTTGGCGGAATGATCTTTGTCAGTATCGGAAACTCG ATCTTTACAAACTCCCTTGTCAACTCACTTGCTCACAATGTGCCATCGGTAAATCCAACC ATTATCACTACAACCGGAGCAACTGACATCAAGAATATCGTATCCGCGGAGGAGCTGCCC AAGGTACTCATAGCATACAACCATGCTCTAGACCAGGCATTCTTGGCAGCTGCTGCCATG GCCGCTCTCTCCGTCTTTGGCAGTGTCCTGGTTCCGTGGTTGAGTGTAAAGCAGAACTAC CACGAG >FGENESH: 1 5 exon (s) 14 - 2189 582 aa, chain - MPNTVFSCMVSRKLGYLNIMLSLNTERSKGTTGDSLELTDVLKNGTLSTLANEDICEKND SSTSGSRETVGRAKDDTNYPKGAKMFLIVVSLCLAVFLMALDNSVITTAIPKITDDFGSV LDVGWYGSAYLLTTASLQLIFGKIYTFWSIKLVFLSTIAVFELGSLICAVAPSSTAFIVG RAIAGSGSAGIFSGALLIITHTSPLAKRPTYIGLAGGMYGIASVAGPIIGGVLTDNVSWR WCFYINLPLGGVTALAIWLILKDPQRDVPTLQTWMDRIRVLDPIGTLIFLPAMVCLLLTL QWGGSKYSWNDGRIIALLVLSGVLIIAFLLIQLRLQEAATVPPRIFRNRSVWAGCLYGFC TSSAFFLVIYYIPIWFQAIQGVSAIESGIRNLPMMISTILMSIMVGGLVTALGYYTPFMI AAAILSSVGAGLLSTFAVHTSSGKWIGYQILFGIGYSLGSRQPLVAVQAALETKDIPIGT SIIMFLQTLGGMIFVSIGNSIFTNSLVNSLAHNVPSVNPTIITTTGATDIKNIVSAEELP KVLIAYNHALDQAFLAAAAMAALSVFGSVLVPWLSVKQNYHE >FGENESH:[mRNA] 2 2 exon (s) 2880 - 4050 1098 bp, chain + ATGGCCATCTCTAAAACACAAACAGCAGTCATCCAGACAAACGAAAAGTCATCGCTTCCA TTGATCGTATCGCAGTCGGTACCAACGTTTCAACTGCCTTCCGAGCAATATGTACTGGTT CGTGTGCTGGCCGTGGCCCTGAATCCTACAGATTTCAAAATGGTACAGCACTTTCCAATC GGAGACAATCTCGCTGGTTGCGACTTTTGCGGAATTATCGAGGCATGCGGCAGCAACGAC ACTGCCAACCAATTTCCAATTGGAACACGAGTATGCGGTGCGGTGTTTCCTTACAACCCC AGTCAGCGCCAAAGCGGTGCCTTTGCGGAATGGGTGATTGCCGACTCTGGTTTATTGCTG

AAGGTCCCGGAAGGTTGGGATGACCTCGATGCAGCGGCTTTAGGTGGAGTCAGCTGGGGT ACCTCAGTACTGGCTTTTTATGATCCTGATGCGCTGGCACTCATTGGTCGTCCCACTAAG CCGAGTGAGAAAAGGGAACCAGTTTTGGTTTACGGAGCTGGCACAGGATCTGGCACAATG GCTTGTCAATTACTAAGGCTAGCTGGATACGCACCAATTGCAGTTGCTTCTTCGAAATCG GCAGCTATGGCTATGGAATACGGCGCAATTGGTGTTGCAGATTATACATCCTCAACTTGT GCTGAAACAATCAAACAACTCGCTGGCGGCGCTCCAATCCGATATGTTCTTGATTGCATA ACCACGGCGGAATCAGCTGCACTTTGCTTCAGTCTTATTGCCCGTACTGGTGGTCGCTAT GCTTGCCTTGAAGAGTTGAGACCAGCTTGGAGAACACGTCGAACAGTTCGCGTTAAGGAA GTCATGGGCTTCGAAGGCCTTGGAATAAAAATTGATTTAGGACCGACGGCCTATTCACGC GACGTCAATCTTACCCTTCGCAAAATTTGCTGCGAAGCTACCAAGGAGATTCAGACGGTT CTCGATGAAGGGTTACTAAAGCCACATCCTGTTCGTGAGGTTACAGGACAATGGCAAGGC ATCATTGATGGACTAGCTATGCTTCAGCGAGGAGACGTAAAAGGACAAAAGCTAGTGGTC AGGGTTTCTACGATATAA >FGENESH: 2 2 exon (s) 2880 - 4050 365 aa, chain + MAISKTQTAVIQTNEKSSLPLIVSQSVPTFQLPSEQYVLVRVLAVALNPTDFKMVQHFPI GDNLAGCDFCGIIEACGSNDTANQFPIGTRVCGAVFPYNPSQRQSGAFAEWVIADSGLLL KVPEGWDDLDAAALGGVSWGTSVLAFYDPDALALIGRPTKPSEKREPVLVYGAGTGSGTM ACQLLRLAGYAPIAVASSKSAAMAMEYGAIGVADYTSSTCAETIKQLAGGAPIRYVLDCI TTAESAALCFSLIARTGGRYACLEELRPAWRTRRTVRVKEVMGFEGLGIKIDLGPTAYSR DVNLTLRKICCEATKEIQTVLDEGLLKPHPVREVTGQWQGIIDGLAMLQRGDVKGQKLVV RVSTI >FGENESH:[mRNA] 3 7 exon (s) 5007 - 8805 2889 bp, chain - ATGGATCAACGTCTCAGTCAAGCAATGCAGGTCACGGAACCTCTAACACAATATACGCTG GGAATCCTTGGAAATCGTAACGTCATTTGGCCGCTCCTCATCCTTTTGTCCCTCACAGCA TGGAGGTTTATAAGTTCACGGGGAGAGCCCGTCAAACTATCTGACCCGATTCCTGGCATA TATAACACTGTTCAGTTCTTGACCAATAATGAAAAGTTTATGAAACGCGTAATGAAACTA CTGAGCAAGAACAGCATTGCGAAATTCTACATGGGAACAGTGCCGGTCTACCTCATCTCC GGAACAAAACATATACAGTCCATATTCGGCAGGGACAACAAAGTCGGAAGCGAAGAAATT TTCACTCAGGCTGTTCTTCCCACTCTTTACAAAATGCCCAAGAGCCATGTAGAGCGCTTT GCCAACGACAAGTCCGGGCGAGGTCATGTTCCTGCACCAGGCACGGAAGGCACACCAAAG GAACAGCGATACTGGGCGAGATACGAACAAATTCATACAGAATATTTGGCGAGAACGCAA CACTTGAAGCCTATTATTCAGGCATATAGCAATCAGCTTGCGCACGATCTTAATAAATAT CCTCTTGAAAAGTGGACTACGCTAGGTGTGGTTGAAACGTGCCGACGCGAGGTGACCAAA TGCGCCATGAGTACTTTGTTGGGCCCTAAGGTCTTCGAGTTGGACCCAGACTTCTTGGAT ACATTTTGGGAATTCGATCATAATGTGTTTATGCTTACATTGGGCTTTCCCAAATGGCTC AACCCAGGCCCTTACAATGCCCAGGACAAGTACCTCTCTACGATCGAGAGGTATGTTCAT GCTGCTTGGGACAACTTTGACTGGAATGGGCCGGACGCCGAATCGAGCTGGGAACCTCAT TTCGGTGCTCGCGTTTGTCGCGAGATTGCAAAGTGGTTCAAGGAAAGTGGCTTTCCAGAC GTATCCATATCTGGTGCACTTGGAACTCTTCTCTTCGCACAGAATTCCAATACTATCCCA ACCACAATGTGGATGATTCTCCGGATCTTCCAGGATTCGTGCCTACTACAAGCGGTCCGG GAAGAAGTAGCTACAACCTACTCCATCGACCCTGTAACTGGTGAACATATTTGTGATATT CAGAAGTTAGTAGTCTTGCCCTTGCTACAGTCAGTTTTTACCGAAGTTCTGCGATTGCAC ATGAATTTCAACATTATTCGCCACGCCAAAGAAAACATCACCATGGACGGATACAATATT CGAAAGGGGGCCATGTTACAGGTCCCTATGATGGCTGCGCATTACGAAGAAAGTGTCTGG GGATCAAGTGGACACCCTGCTTCTGAATTCTGGGCTGAGCGACACATCAAATACGTGGAG GACACCAAGGAGGACGGCAAGACTGAGCGCAGACGTGTCTTTGCTATGGCGGGGCGGCCG AGTTCCTACTTTCCTTTCGGCGGCGGTCCACCCGTTTGTCCTGGACGACACTTCGCTAAA CACGAGATCCTGACTACAATAGGCATGTTAGTATCGAAATTCGACATAGAGGTTGTTAAA

TGGGTGAAATTGGACGGATCTCCTTCAGACCGACCAGCGCAGAATAACCAAACCTATTGC GGAGCAGGTACTATGCCTCCAGATCGTGAGATGAAGATCAGAATAAAGCGACTTTGTGAG CATCCTGGAGGACAATCAAAGTATGTGCATGTATCGCTCCGAGAGGAGCTATTCATGTGG CAGAGATTGAAGCAGATATGTCCCAAATTTTCGTCCAATGGCGCTTGGTACACTATTTAT GGAAAAGATACATGTCAACCAGAGCTGTGTTTACTTCTACGAAACATTTACGACCCGGAA AACACGTCAATCTGCAATACGATAAGAAAAGTAATGGCACCTGGTCCATCACTACGAAGC ACTTGGGCTTCATTTCGCCCTCCTAAACCCGAATTTACCGAGAAAAATGTGCCTAGTCTT GAAGGCAAGGTGTATCTAGTTACCGGCTCCAACACAGGGGTTGGAAAAGAAACAGCTCGC ATTCTCTACTCAAAGGGGGCTAAAGTGTGGATGGCTGCGCGCTCTACGGAGAAGGCGAGC GTAGCTATTGACGAGATCAGGAATTCTCAGCCCAGTTCTACCGGTTCATTGCATTTTCTT CATTTGGATCTTAGCGATCTCAGCACGGTGAAGCAATCCGCCGAGCTATTCTTGTCGCAG GAACAAACGCTCCATGTTCTTTTCAACAATGCCGGCGTAATGGTTGGGACACCAGAGGCA ACGAATACTGTTCAAGGCCATGAGCTTGCGCTCGGTGTCAATTGTATCGGAACGCATCTC TTCACCAGGCTTGTTACAGCTCTTCTGGCAAAGACAGCAAAATCCGAGCCCGAAGGTTCG GTCCGTGTGATCTGGCTTTCTTCATTTGGATTAGAGCTTTTCGGTGCAGAAAATGTGGGC GTTGCACTCGACAATCTGGATTATCATGAGCCCAAACCAGCAACTGAGAGATACGGAATC AGCAAGTGTGGTGCTTGGGCACTTGGTGTGGAGTATGCCCGGCGTCACAAAGCAGATGGC ATTGTGAGTGTACCGATCAACCCAGGTAATCTGACCTCGGAACTTGCTCGCGACCAACCC GCAGCCTTGAAGGCAATTGTCAAAGTAGTCGGTTATCCCCCTATAATGGGTGCATACACC GAGCTTTTTGCCGCATTGTCGCCAGAAATCACCTTGGAAAAGTCGGGAGAATGGGTGGCT CCTTTCGGAAGATTCTACCCCTTGCGACCGGACCTGATAAATGCGACGAAGCTCGAGTCG GAGGGTGGCACAGGTGGTGCGTATAAATTTTGGGAGTGGACTGAGCAGCAAATCAAGGAC TATATTTGA >FGENESH: 3 7 exon (s) 5007 - 8805 962 aa, chain - MDQRLSQAMQVTEPLTQYTLGILGNRNVIWPLLILLSLTAWRFISSRGEPVKLSDPIPGI YNTVQFLTNNEKFMKRVMKLLSKNSIAKFYMGTVPVYLISGTKHIQSIFGRDNKVGSEEI FTQAVLPTLYKMPKSHVERFANDKSGRGHVPAPGTEGTPKEQRYWARYEQIHTEYLARTQ HLKPIIQAYSNQLAHDLNKYPLEKWTTLGVVETCRREVTKCAMSTLLGPKVFELDPDFLD TFWEFDHNVFMLTLGFPKWLNPGPYNAQDKYLSTIERYVHAAWDNFDWNGPDAESSWEPH FGARVCREIAKWFKESGFPDVSISGALGTLLFAQNSNTIPTTMWMILRIFQDSCLLQAVR EEVATTYSIDPVTGEHICDIQKLVVLPLLQSVFTEVLRLHMNFNIIRHAKENITMDGYNI RKGAMLQVPMMAAHYEESVWGSSGHPASEFWAERHIKYVEDTKEDGKTERRRVFAMAGRP SSYFPFGGGPPVCPGRHFAKHEILTTIGMLVSKFDIEVVKWVKLDGSPSDRPAQNNQTYC GAGTMPPDREMKIRIKRLCEHPGGQSKYVHVSLREELFMWQRLKQICPKFSSNGAWYTIY GKDTCQPELCLLLRNIYDPENTSICNTIRKVMAPGPSLRSTWASFRPPKPEFTEKNVPSL EGKVYLVTGSNTGVGKETARILYSKGAKVWMAARSTEKASVAIDEIRNSQPSSTGSLHFL HLDLSDLSTVKQSAELFLSQEQTLHVLFNNAGVMVGTPEATNTVQGHELALGVNCIGTHL FTRLVTALLAKTAKSEPEGSVRVIWLSSFGLELFGAENVGVALDNLDYHEPKPATERYGI SKCGAWALGVEYARRHKADGIVSVPINPGNLTSELARDQPAALKAIVKVVGYPPIMGAYT ELFAALSPEITLEKSGEWVAPFGRFYPLRPDLINATKLESEGGTGGAYKFWEWTEQQIKD YI >FGENESH:[mRNA] 4 5 exon (s) 9547 - 11535 1521 bp, chain - ATGACTACTATTATAGCTCTTTGGCAACTTCTCCAACCTGATAAGTTGGGCTTTTGGGTC AATCTTGGAATTATCCTAACAGCGGTATTTTGTCTTTGGAGCGCAGTAACGGCCATATAC AATATCTTCTTCCACCCTTTGTGTCACTTTCCTGGGCCAATAGTTCATTGTATCTCCCGT ATTCCATGGGCTATTCGTCATGCGCGCGGCGAACAAGCATTTTACACCCAACGACTCCAT GACATGTATGGGCCGGTTGTGCGCATTGCGCCCAACCACCTCTCATTCACCGATCCACGG GCATGGAAGGATATTTATTACCACCGTGTTGGGGCTGTAGGTGGTATGGTGGAAATGGCC

AAGTCTACCGAGTTCACGCGAAATGTCAAAGGCCAACTTACCACCATTGTTAATGCCGAC CAAGACGAACATCAACAACTGAGACGAGCGCTTTCTCATGGCTTCTCGGACAGCTCCATG AGACAGCAAGAACCCACCATGCTCAAACACATAAACATGCTAGTGGATAGACTACGAACG GAGTCTGGCAAAAATCCGGATATGGCGGCATGGTATAACTGGACAACCTTTGACCTCTCG AGTGATCTGATTTTTGGAGAGTCGTTCCATTGTCTTCAAACAGTCAATTATCACCCATGG GTTGCTACTATCATGAAGGCTATCAAGTTTCATGCGTTCATGGTAGCTCTAGGTTATGGC GGTGCTAGGCCGCTGGTCGAATTGATCCACAAAGCCGGTGGATTTCTCGCGATGAAAACA ATGCGCGGTTATATCGATAGTATGCTAAAGTCAAGGCTGGCAATGAAGCAAAGGCATGAT GACCTTTTTGAAGGTTTGGCTAAAAGACGAGATGAATGGGATAAACTCAGCGTGAATGCC ACTGTCCTACTCCTAGCTGGCTCCGAAACCACTGCAACTTGTCTATCTGGCACAACCTAT TTCCTTCTGACGCATCCAGAGGTCTTGGAGAAGGTGACCGCGGAGATCAGATCTGCCTTC TCAACAGACGCGGATATAAATATTCAATCAGTAAACAAATTGACATACTTGATTCCTGTA TTAAACGAATCTTTGCGAATGTACCCACCTTTGACCTCTGGAATGGTGCGAGAAGTCCCT ACAGGAGGTGCTGAGATCGCAGGGCGATTCGTTCCCGGTGATACCCTAGTTGAGATCCAA CATTGGTCGATAAATCACAGCAAGGAGAACTGGGTCGACCCTTGGTCGTTTCGCCCTGAA CGTTTTATGGTGGATGTCAAAGTAGCCAAGGAACACAGTGATATGTTGGAAGCCGTTCAA GCATTTAGCATGGGACCGCGGAATTGCATCGGAAGAAATCTTGCAATGACGGAAATGCGT CTTATCTTGGCTAAGATTCTCTATAATTTTGATATGAAACTTGCGAATGGCAGCCATAGC TGGATCGAGAGGCAGAAGAATTACAACGTGTGGGATCGGATACCATTGAATGTGACTTTA ACGCCCGTCGAAGTGAAATAG >FGENESH: 4 5 exon (s) 9547 - 11535 506 aa, chain - MTTIIALWQLLQPDKLGFWVNLGIILTAVFCLWSAVTAIYNIFFHPLCHFPGPIVHCISR IPWAIRHARGEQAFYTQRLHDMYGPVVRIAPNHLSFTDPRAWKDIYYHRVGAVGGMVEMA KSTEFTRNVKGQLTTIVNADQDEHQQLRRALSHGFSDSSMRQQEPTMLKHINMLVDRLRT ESGKNPDMAAWYNWTTFDLSSDLIFGESFHCLQTVNYHPWVATIMKAIKFHAFMVALGYG GARPLVELIHKAGGFLAMKTMRGYIDSMLKSRLAMKQRHDDLFEGLAKRRDEWDKLSVNA TVLLLAGSETTATCLSGTTYFLLTHPEVLEKVTAEIRSAFSTDADINIQSVNKLTYLIPV LNESLRMYPPLTSGMVREVPTGGAEIAGRFVPGDTLVEIQHWSINHSKENWVDPWSFRPE RFMVDVKVAKEHSDMLEAVQAFSMGPRNCIGRNLAMTEMRLILAKILYNFDMKLANGSHS WIERQKNYNVWDRIPLNVTLTPVEVK >FGENESH:[mRNA] 5 5 exon (s) 12442 - 14331 1548 bp, chain + ATGGAGGCCGTCTTAGAGACAGGAATGACATTCGTGTCGAGCCTCACAATGAGGGACATG TTGGCTTTGGCCGTTTCCACGACTCTTCTGGTGCCAATCACTTGGATGATCTATAACCTC TATTTTCACCCGCTGGCGCGCTTCCCTGGACCCTTTTGGCACCGTGCTACACGTCTTGCA TACGTTATCAAAATGAACAAAGGAACACTTGCTTTCGACGTGCTTCCTATGCATAAGAAG TACGGTCCCGTTGTTCGAATTGCGCCTAACGAACTCTCCTTTCAAACTCCCCAGGCATGG AAAGATATTTATGGTCATCGGACCGGCACCGCTGCCGGAGCTGAGGAAATGGACAAGTAT CATACATTCTACCGTACCAAGGGAGAGGTTCTCAGCATCAGCTCAGGAGGTCGCGAGTAT CATGGAATTCTTCGTCGTCAATTAGCATACGGATTCAGCGACCGCGCCATGCGCGAGCAG GAGCCTATCATTGGCAGTTACATTGATTTGCTGATCAAGAGACTCCATGAAAACTGCGTT GATCCCAACGTGAAGGATCCCAAGACAGGAAACCCAGCGGAGAAAATGCTAAACATGGTC TCCTGGTACAATTGGACCACATTTGATGTGATTGGTGATTTGGTCTTTGGCGAGTCCTTT GGATCGCTTGAAAATGGAAACTATGACCCTTGGGTAGCCGCTATCAATGACTCTATCAAA TTCCTTGGTGTTATCAATGGAGTCAAGCATATGGGTCTTGAATCTCTGTTCATTTGGGTT GTTAAAAAACTTAATACCGGCCGCCGTGAGCACACAGATCGATTGGTCAAGAAGCTTCAG AAACGTATCAATCTCGGCGTTGAGCGTTTAGACTTGATCGAAGGCTTGCTACAGAAGAAA GATGAATGGAACCTATCTATTCACCACCTTGAAGCCAACGGAAGTAGCATCTTGATTGCC GGTTCAGAAACAACAGCTACAATGTTGAGTGGTGTTACCTATATGCTCCTTACACACCCA

GAGGCCCTCCGCAAAGTTACCAAAGAAGTGCGCACCACTTTCAAGTCCAGCGAAGAGATC ACATTGACATCTGTCAGTTCTCTTACGTATATGCTTGCCTGCTTGAATGAGTCACTGCGT GCTTACCCTCCTGTCCCTTTTGGCATGCCTCGCCAGGTTCCAAAGGGCGGAGCCACCATT GCCGGAGAATATGTCCCAGAAGACACCGTCGTCGCTATTTGGCACTGGGCTGCCTACCAT AACGACCAGCTATGGACCGATCCATTCGGCTATCATCCAGAGCGCTATCTCCACGATCCC AGATTTGCTAATGATGCTTTTGCAATCCACAATCCATTCTCCCACGGGCCCAGAAATTGC ATTGGAAGACATTTGGCATACGCAGAAATGAGACTTGTATTGGCGCGCCTCCTTTTCGAT TTTGAGATGCGTTTGGCAGATCCTGACTTAGACTGGTTGAACCACAAATCTTATGTGCTG TGGTCGAAGCCAGCTTTGAACGTATATTTGACTCCTCGTGAATTTTAA >FGENESH: 5 5 exon (s) 12442 - 14331 515 aa, chain + MEAVLETGMTFVSSLTMRDMLALAVSTTLLVPITWMIYNLYFHPLARFPGPFWHRATRLA YVIKMNKGTLAFDVLPMHKKYGPVVRIAPNELSFQTPQAWKDIYGHRTGTAAGAEEMDKY HTFYRTKGEVLSISSGGREYHGILRRQLAYGFSDRAMREQEPIIGSYIDLLIKRLHENCV DPNVKDPKTGNPAEKMLNMVSWYNWTTFDVIGDLVFGESFGSLENGNYDPWVAAINDSIK FLGVINGVKHMGLESLFIWVVKKLNTGRREHTDRLVKKLQKRINLGVERLDLIEGLLQKK DEWNLSIHHLEANGSSILIAGSETTATMLSGVTYMLLTHPEALRKVTKEVRTTFKSSEEI TLTSVSSLTYMLACLNESLRAYPPVPFGMPRQVPKGGATIAGEYVPEDTVVAIWHWAAYH NDQLWTDPFGYHPERYLHDPRFANDAFAIHNPFSHGPRNCIGRHLAYAEMRLVLARLLFD FEMRLADPDLDWLNHKSYVLWSKPALNVYLTPREF >FGENESH:[mRNA] 6 3 exon (s) 15265 - 16021 537 bp, chain - ATGATGACTTTGGATCTTGAGAGACAACTCGTCTTTTATGGCACTTACCACCATAATCCG GGGTATTGTGTATTGACCGTCGTCTCATCACAGTTCACCAACACACCAACGCTCATCCCC CTGCCGGACTTTCTTCAATACAAATACCTCCCTCTCAACGCCGGCACAATCCAATCCCTA ATCTACGCCCTGGGCTACATCCTCCTCGAGCCGGTCGTCGGTCTGATATGCGTTCCTACT CTGCTGGGTGCCGCCGCCTACATGAATTACCTCACAATGACCTACGGCGCGACTGCTACA TCCTGGTCCTTCGGAATCTTTATCGTGTCATGGATTGCTCAGTTTATTGGCCATGGAGCC TACGAGGGACGATCGCCGGCTTTGTTGGATAATCTTTTCCAGGCGCTGTTTTTGGCGCCG TTGTTTGTGTTTTTGGAGTATTTGTTTATGTTTGGGTATCGGCCGGAGTTGCAGCGGAGG GTCGAGGCGGAGGTGCAGAAGAAGCTTGCGCAGTTGAACACGCCGAAGAACAAGTGA >FGENESH: 6 3 exon (s) 15265 - 16021 178 aa, chain - MMTLDLERQLVFYGTYHHNPGYCVLTVVSSQFTNTPTLIPLPDFLQYKYLPLNAGTIQSL IYALGYILLEPVVGLICVPTLLGAAAYMNYLTMTYGATATSWSFGIFIVSWIAQFIGHGA YEGRSPALLDNLFQALFLAPLFVFLEYLFMFGYRPELQRRVEAEVQKKLAQLNTPKNK >FGENESH:[mRNA] 7 3 exon (s) 17133 - 17895 621 bp, chain + ATGTTCTTCCTCAAAGAGGAAACCAAAGTCGTCACCCTCCACCCGTCCTTTTTCGGACCC AATGTCAAGGAATATCTGATCAACCGCTTGAACGAAGAAGAAGAGGGACGATGTACGGGT GATCATTTCGTGATTTGTGTCATGGACATGGTGGATATTGGCGACGGGCGAGTGATACCG GGCAGTGGACATGCAGAATATACTATCAAATATCGCGCGATCATATGGAAGCCTTTCCGA GGGGAGACGGTCGATGCCATCGTGACCTCGGTTAAACCCACCGGTATCTTCACGCTCGCG GGCCCTCTGTCGGTGTTTATTGCGCGCAAAAATATACCATCAGATATCAAATGGGAACCC GGCACCGTGCCGCCCCAATATACGGATCATGCAGACCAGGTTATTGAGCGAGGAACGAGT CTGCGGTTGAAGATACTGGGTGTGAAGCCAGATGTGTCTGCGATTAATGCGATTGGCACC ATTAAGGAGGATTATCTTGGAGAATCGTCTCCCTCAGCACTCGATGATGCCGAATTTCTA CCCGCGACTGCCCTACGAAGAATGGCGGCGTATATGCCTGGTTCTGCGAGTGTTCGACAA CAAGTGACTTCGGGCTGGTGA >FGENESH: 7 3 exon (s) 17133 - 17895 206 aa, chain + MFFLKEETKVVTLHPSFFGPNVKEYLINRLNEEEEGRCTGDHFVICVMDMVDIGDGRVIP GSGHAEYTIKYRAIIWKPFRGETVDAIVTSVKPTGIFTLAGPLSVFIARKNIPSDIKWEP

GTVPPQYTDHADQVIERGTSLRLKILGVKPDVSAINAIGTIKEDYLGESSPSALDDAEFL PATALRRMAAYMPGSASVRQQVTSGW >FGENESH:[mRNA] 8 2 exon (s) 19088 - 19993 843 bp, chain + ATGGCGCTCAAAGCAGTCTACGAGCGATTCCTCTCCTCCCCAACCTCTGGCGCCCTGAGC GCCGATGTCTCAGTCAACTACATCACGACGGCAACCTCAATCACGGGCAGCGAACAGGTC CTCAAGCATCTGAGTAACCAGGAGAAGGCAGTCAAGAAAAAGGGAGACAAGATCCTCGGC ATCGTCGAGACTCCGGATACTATTGTCCTGGACGTGGAGACTACACTGGAGTTTGTGACT GGGGGTGGGGCTTATCTGCCCTCGCTGGACGATAATTTCCTAGCCGACCGCGTAGTGACT TTTCCCACGATACACATTGTTCACTTCAATTCGCAATCCCAGATCCAACAGGTCAGAGTC TATTGGGACCAGGGTTCGCTCTTGAAACAAGTCGACGTCATCGGTTCTCGTGGAAAGAAT TGGCCCATTCGCGATGCTAAGGATCAGTCGAAGTTGATTGCCAATGTAGCAACTGCACAG GGTATCACCACACCCCCGCCCCAAAAACAGGTCCCCGTCGCAGTTGGAAAAGCGCCTGGT TCGTCTAGACCTCCTTCGCGCTCGCCCAGCGAGATTTTTGGCGGCAGTGATGACGTTGAG AACGAGCCCACTCCTCGCGCTCGCGATAGCATCATTTCGCCTCGAGCTGGCGCTGCGAAG CACTTCCGACCTGTCCGTGTTTTTGGTGAAGACGATGAAGATGTCACTTCAAGCCCCATC AAGCCCAAGATTGGTTCGAACAAGGGATTCCAACCCGTGCGCGTATTCGACGTAGAGCAA CATGAAGCCGAAGTCGCTCAGCAGCCACGAGCCGGAGCGACTAAGAACTTCCAACCCATC CGT >FGENESH: 8 2 exon (s) 19088 - 19993 281 aa, chain + MALKAVYERFLSSPTSGALSADVSVNYITTATSITGSEQVLKHLSNQEKAVKKKGDKILG IVETPDTIVLDVETTLEFVTGGGAYLPSLDDNFLADRVVTFPTIHIVHFNSQSQIQQVRV YWDQGSLLKQVDVIGSRGKNWPIRDAKDQSKLIANVATAQGITTPPPQKQVPVAVGKAPG SSRPPSRSPSEIFGGSDDVENEPTPRARDSIISPRAGAAKHFRPVRVFGEDDEDVTSSPI KPKIGSNKGFQPVRVFDVEQHEAEVAQQPRAGATKNFQPIR