biotech report

profileA11113
augustusresults.docx
# This output was generated with AUGUSTUS (version 3.3.3).
# AUGUSTUS is a gene prediction tool written by M. Stanke ([email protected]),
# O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initializing the parameters using config directory /data/www/augustus/augustus/config/ ...
# aspergillus_fumigatus version. Using default transition matrix.
# Looks like /data/www/augustus/webservice/data/AUG-193441470/input.fa is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 20001, name = 42) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
42	AUGUSTUS	gene	1	1902	0.55	-	.	g1
42	AUGUSTUS	transcript	1	1902	0.55	-	.	g1.t1
42	AUGUSTUS	internal	1	1048	0.81	-	0	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	internal	1118	1443	1	-	2	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	internal	1512	1591	0.87	-	1	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	initial	1655	1902	0.72	-	0	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	intron	1049	1117	0.99	-	.	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	intron	1444	1511	1	-	.	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	intron	1592	1654	0.78	-	.	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	CDS	1	1048	0.81	-	0	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	CDS	1118	1443	1	-	2	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	CDS	1512	1591	0.87	-	1	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	CDS	1655	1902	0.72	-	0	transcript_id "g1.t1"; gene_id "g1";
42	AUGUSTUS	start_codon	1900	1902	.	-	0	transcript_id "g1.t1"; gene_id "g1";
# coding sequence = [atgctctcgcttaacacagaacggtcgaagggaactactggcgattccttagaattgacagatgttctgaaaaatggca
# cactatcaacactggccaatgaggatatctgtgaaaaaaatgacagctctacttcaggatcacgagaaacagttggccgagcgaaagatgacacaaat
# tacccaaagggcgcgaaaatgtttctcatagtggtctctctgtgtcttgcagtcttcttgatggctttagacaactcggtgataaccacagcgattcc
# aaaaatcactgatgactttggtagcgtgttagatgtagggtggtacggaagtgcttacttgctgacaactgcctccctgcaactcattttcggcaaga
# tttacacattttggagcatcaaattggttttcttatcgaccatcgccgtattcgagctcggtagcttaatatgcgccgtcgcaccttcatcaacggct
# tttatcgtcggacgagcaattgctggatctggttctgccggtatattttccggtgctctgctcatcatcacccatacttctcctctggcaaaacgacc
# aacatatatcggtttagcgggcggtatgtatgggatagcatctgtggctggtcctatcatcggaggcgtccttactgacaatgtgtcttggcgatggt
# gcttttatataaatctaccactgggcggcgttacggctctggccatctggttgatcctcaaggatccgcaacgagatgtgccaacgcttcaaacttgg
# atggatcgcataagagtcttggatcccattgggaccctgattttcttaccagcaatggtttgcctgttgctcaccctacaatggggaggttcgaagta
# cagctggaatgatgggcgaatcattgctcttctggttctttctggcgttctgatcatagcttttctgcttatccagcttcgcctacaagaagctgcaa
# cagtgcctccgcgcatctttcgcaatcgttccgtgtgggctggttgcctctacgggttttgtacaagttcggcattttttcttgtcatatactacatc
# cccatttggttccaggcaatacaaggagtttcagctattgaatccggcattcgaaaccttccaatgatgatttcaacaattctcatgtctataatggt
# cggcggcctggtgacggctctaggatactatacgccgttcatgattgcggcagcaattctttcctctgtcggagcaggtcttctctctacttttgcag
# ttcatacctcaagcgggaaatggattggttatcagatcctgttcggcatcggatacagtctcggttcaagacagcctttggtggctgttcaggcagcc
# ctagaaacaaaggacatacctattggtacatctatcattatgtttctgcaaacacttggcggaatgatctttgtcagtatcggaaactcgatctttac
# aaactcccttgtcaactcacttgctcacaatgtgccatcggtaaatccaaccattatcactacaaccggagcaactgacatcaagaatatcgtatccg
# cggaggagctgcccaaggtactcatagcatacaaccatgctctagaccaggcattcttggcagctgctgccatggccgctctctccgtctttggcagt
# gtcctggttccgtggttgagtgtaaagcagaactaccacgaggtggatgaaccag]
# protein sequence = [MLSLNTERSKGTTGDSLELTDVLKNGTLSTLANEDICEKNDSSTSGSRETVGRAKDDTNYPKGAKMFLIVVSLCLAVF
# LMALDNSVITTAIPKITDDFGSVLDVGWYGSAYLLTTASLQLIFGKIYTFWSIKLVFLSTIAVFELGSLICAVAPSSTAFIVGRAIAGSGSAGIFSGA
# LLIITHTSPLAKRPTYIGLAGGMYGIASVAGPIIGGVLTDNVSWRWCFYINLPLGGVTALAIWLILKDPQRDVPTLQTWMDRIRVLDPIGTLIFLPAM
# VCLLLTLQWGGSKYSWNDGRIIALLVLSGVLIIAFLLIQLRLQEAATVPPRIFRNRSVWAGCLYGFCTSSAFFLVIYYIPIWFQAIQGVSAIESGIRN
# LPMMISTILMSIMVGGLVTALGYYTPFMIAAAILSSVGAGLLSTFAVHTSSGKWIGYQILFGIGYSLGSRQPLVAVQAALETKDIPIGTSIIMFLQTL
# GGMIFVSIGNSIFTNSLVNSLAHNVPSVNPTIITTTGATDIKNIVSAEELPKVLIAYNHALDQAFLAAAAMAALSVFGSVLVPWLSVKQNYHEVDEP]
# end gene g1
###
# start gene g2
42	AUGUSTUS	gene	2880	4050	0.63	+	.	g2
42	AUGUSTUS	transcript	2880	4050	0.63	+	.	g2.t1
42	AUGUSTUS	start_codon	2880	2882	.	+	0	transcript_id "g2.t1"; gene_id "g2";
42	AUGUSTUS	initial	2880	3439	0.81	+	0	transcript_id "g2.t1"; gene_id "g2";
42	AUGUSTUS	terminal	3513	4050	0.67	+	1	transcript_id "g2.t1"; gene_id "g2";
42	AUGUSTUS	intron	3440	3512	0.88	+	.	transcript_id "g2.t1"; gene_id "g2";
42	AUGUSTUS	CDS	2880	3439	0.81	+	0	transcript_id "g2.t1"; gene_id "g2";
42	AUGUSTUS	CDS	3513	4047	0.67	+	1	transcript_id "g2.t1"; gene_id "g2";
42	AUGUSTUS	stop_codon	4048	4050	.	+	0	transcript_id "g2.t1"; gene_id "g2";
# coding sequence = [atggccatctctaaaacacaaacagcagtcatccagacaaacgaaaagtcatcgcttccattgatcgtatcgcagtcgg
# taccaacgtttcaactgccttccgagcaatatgtactggttcgtgtgctggccgtggccctgaatcctacagatttcaaaatggtacagcactttcca
# atcggagacaatctcgctggttgcgacttttgcggaattatcgaggcatgcggcagcaacgacactgccaaccaatttccaattggaacacgagtatg
# cggtgcggtgtttccttacaaccccagtcagcgccaaagcggtgcctttgcggaatgggtgattgccgactctggtttattgctgaaggtcccggaag
# gttgggatgacctcgatgcagcggctttaggtggagtcagctggggtacctcagtactggctttttatgatcctgatgcgctggcactcattggtcgt
# cccactaagccgagtgagaaaagggaaccagttttggtttacggagctggcacaggatctggcacaatggcttgtcaattactaaggctagctggata
# cgcaccaattgcagttgcttcttcgaaatcggcagctatggctatggaatacggcgcaattggtgttgcagattatacatcctcaacttgtgctgaaa
# caatcaaacaactcgctggcggcgctccaatccgatatgttcttgattgcataaccacggcggaatcagctgcactttgcttcagtcttattgcccgt
# actggtggtcgctatgcttgccttgaagagttgagaccagcttggagaacacgtcgaacagttcgcgttaaggaagtcatgggcttcgaaggccttgg
# aataaaaattgatttaggaccgacggcctattcacgcgacgtcaatcttacccttcgcaaaatttgctgcgaagctaccaaggagattcagacggttc
# tcgatgaagggttactaaagccacatcctgttcgtgaggttacaggacaatggcaaggcatcattgatggactagctatgcttcagcgaggagacgta
# aaaggacaaaagctagtggtcagggtttctacgatataa]
# protein sequence = [MAISKTQTAVIQTNEKSSLPLIVSQSVPTFQLPSEQYVLVRVLAVALNPTDFKMVQHFPIGDNLAGCDFCGIIEACGS
# NDTANQFPIGTRVCGAVFPYNPSQRQSGAFAEWVIADSGLLLKVPEGWDDLDAAALGGVSWGTSVLAFYDPDALALIGRPTKPSEKREPVLVYGAGTG
# SGTMACQLLRLAGYAPIAVASSKSAAMAMEYGAIGVADYTSSTCAETIKQLAGGAPIRYVLDCITTAESAALCFSLIARTGGRYACLEELRPAWRTRR
# TVRVKEVMGFEGLGIKIDLGPTAYSRDVNLTLRKICCEATKEIQTVLDEGLLKPHPVREVTGQWQGIIDGLAMLQRGDVKGQKLVVRVSTI]
# end gene g2
###
# start gene g3
42	AUGUSTUS	gene	5007	11216	0.08	-	.	g3
42	AUGUSTUS	transcript	5007	11216	0.02	-	.	g3.t1
42	AUGUSTUS	stop_codon	5007	5009	.	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	terminal	5007	5140	0.94	-	2	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	5204	6039	0.4	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	6897	7113	0.53	-	2	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	7180	7640	0.84	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	7711	8475	0.61	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	9599	9709	0.42	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	9787	9962	0.85	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	10051	10353	0.65	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	internal	10496	10522	0.33	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	initial	10581	11216	0.33	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	5141	5203	1	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	6040	6896	0.39	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	7114	7179	0.94	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	7641	7710	0.75	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	8476	9598	0.35	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	9710	9786	0.82	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	9963	10050	0.97	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	10354	10495	0.44	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	intron	10523	10580	0.33	-	.	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	5010	5140	0.94	-	2	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	5204	6039	0.4	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	6897	7113	0.53	-	2	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	7180	7640	0.84	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	7711	8475	0.61	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	9599	9709	0.42	-	1	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	9787	9962	0.85	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	10051	10353	0.65	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	10496	10522	0.33	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	CDS	10581	11216	0.33	-	0	transcript_id "g3.t1"; gene_id "g3";
42	AUGUSTUS	start_codon	11214	11216	.	-	0	transcript_id "g3.t1"; gene_id "g3";
# coding sequence = [atgtatgggccggttgtgcgcattgcgcccaaccacctctcattcaccgatccacgggcatggaaggatatttattacc
# accgtgttggggctgtaggtggtatggtggaaatggccaagtctaccgagttcacgcgaaatgtcaaaggccaacttaccaccattgttaatgccgac
# caagacgaacatcaacaactgagacgagcgctttctcatggcttctcggacagctccatgagacagcaagaacccaccatgctcaaacacataaacat
# gctagtggatagactacgaacggagtctggcaaaaatccggatatggcggcatggtataactggacaacctttgacctctcgagtgatctgatttttg
# gagagtcgttccattgtcttcaaacagtcaattatcacccatgggttgctactatcatgaaggctatcaagtttcatgcgttcatggtagctctaggt
# tatggcggtgctaggccgctggtcgaattgatccacaaagccggtggatttctcgcgatgaaaacaatgcgcggttatatcgatagtatgctaaagtc
# aaggctggcaatgaagcaaaggcatgatgacctttttgaaggtttggctaaaagacgagatgaatggtctccattctttaggggctatcttttggata
# aactcagcgtgaatgccactgtcctactcctagctggctccgaaaccactgcaacttgtctatctggcacaacctatttccttctgacgcatccagag
# gtcttggagaaggtgaccgcggagatcagatctgccttctcaacagacgcggatataaatattcaatcagtaaacaaattgacatacttgattcctgt
# attaaacgaatctttgcgaatgtacccacctttgacctctggaatggtgcgagaagtccctacaggaggtgctgagatcgcagggcgattcgttcccg
# gtgataccctagttgagatccaacattggtcgataaatcacagcaaggagaactgggtcgacccttggtcgtttcgccctgaacgttttatggtggat
# gtcaaagtagccaaggaacacagtgatatgttggaagccgttcaagcatttagcatgggaccgcggaattgcatcggaagaaatcttgcaatgacgga
# aatgcgtcttatcttggctaagattctctataattttgatatgaaacttgcgaatggcagccatagctggatcgagaggcagaagaattacaacgtga
# aactactgagcaagaacagcattgcgaaattctacatgggaacagtgccggtctacctcatctccggaacaaaacatatacagtccatattcggcagg
# gacaacaaagtcggaagcgaagaaattttcactcaggctgttcttcccactctttacaaaatgcccaagagccatgtagagcgctttgccaacgacaa
# gtccgggcgaggtcatgttcctgcaccaggcacggaaggcacaccaaaggaacagcgatactgggcgagatacgaacaaattcatacagaatatttgg
# cgagaacgcaacacttgaagcctattattcaggcatatagcaatcagcttgcgcacgatcttaataaatatcctcttgaaaagtggactacgctaggt
# gtggttgaaacgtgccgacgcgaggtgaccaaatgcgccatgagtactttgttgggccctaaggtcttcgagttggacccagacttcttggatacatt
# ttgggaattcgatcataatgtgtttatgcttacattgggctttcccaaatggctcaacccaggcccttacaatgcccaggacaagtacctctctacga
# tcgagaggtatgttcatgctgcttgggacaactttgactggaatgggccggacgccgaatcgagctgggaacctcatttcggtgctcgcgtttgtcgc
# gagattgcaaagtggttcaaggaaagtggctttccagacgtatccatatctggtgcacttggaactcttctcttcgcacagaattccaatactatccc
# aaccacaatgtggatgattctccggatcttccaggattcgtgcctactacaagcggtccgggaagaagtagctacaacctactccatcgaccctgtaa
# ctggtgaacatatttgtgatattcagaagttagtagtcttgcccttgctacagtcagtttttaccgaagttctgcgattgcacatgaatttcaacatt
# attcgccacgccaaagaaaacatcaccatggacggatacaatattcgaaagggggccatgttacaggtccctatgatggctgcgcattacgaagaaag
# tgtctggggatcaagtggacaccctgcttctgaattctgggctgagcgacacatcaaatacgtggaggacaccaaggaggacggcaagactgagcgca
# gacgtgtctttgctatggcggggcggccgagttcctactttcctttcggcggcggtccacccgtttgtcctggacgacacttcgctaaacacgagatc
# ctgactacaataggcatgttagtatcgaaattcgacatagaggttgttaaatgggtgaaattggacggatctccttcagaccgaccagcgcagaataa
# ccaaacctattgcggagcaggtactatgcctccagatcgtgagatgaagatcagaataaagcgactttgcacttgggcttcatttcgccctcctaaac
# ccgaatttaccgagaaaaatgtgcctagtcttgaaggcaaggtgtatctagttaccggctccaacacaggggttggaaaagaaacagctcgcattctc
# tactcaaagggggctaaagtgtggatggctgcgcgctctacggagaaggcgagcgtagctattgacgagatcaggaattctcagcccagttctaccgg
# ttcattgcattttcttcatttggatcttagcgatctcagcacggtgaagcaatccgccgagctattcttgtcgcaggaacaaacgctccatgttcttt
# tcaacaatgccggcgtaatggttgggacaccagaggcaacgaatactgttcaaggccatgagcttgcgctcggtgtcaattgtatcggaacgcatctc
# ttcaccaggcttgttacagctcttctggcaaagacagcaaaatccgagcccgaaggttcggtccgtgtgatctggctttcttcatttggattagagct
# tttcggtgcagaaaatgtgggcgttgcactcgacaatctggattatcatgagcccaaaccagcaactgagagatacggaatcagcaagtgtggtgctt
# gggcacttggtgtggagtatgcccggcgtcacaaagcagatggcattgtgagtgtaccgatcaacccaggtaatctgacctcggaacttgctcgcgac
# caacccgcagccttgaaggcaattgtcaaagtagtcggttatccccctataatgggtgcatacaccgagctttttgccgcattgtcgccagaaatcac
# cttggaaaagtcgggagaatgggtggctcctttcggaagattctaccccttgcgaccggacctgataaatgcgacgaagctcgagtcggagggtggca
# caggtggtgcgtataaattttgggagtggactgagcagcaaatcaaggactatatttga]
# protein sequence = [MYGPVVRIAPNHLSFTDPRAWKDIYYHRVGAVGGMVEMAKSTEFTRNVKGQLTTIVNADQDEHQQLRRALSHGFSDSS
# MRQQEPTMLKHINMLVDRLRTESGKNPDMAAWYNWTTFDLSSDLIFGESFHCLQTVNYHPWVATIMKAIKFHAFMVALGYGGARPLVELIHKAGGFLA
# MKTMRGYIDSMLKSRLAMKQRHDDLFEGLAKRRDEWSPFFRGYLLDKLSVNATVLLLAGSETTATCLSGTTYFLLTHPEVLEKVTAEIRSAFSTDADI
# NIQSVNKLTYLIPVLNESLRMYPPLTSGMVREVPTGGAEIAGRFVPGDTLVEIQHWSINHSKENWVDPWSFRPERFMVDVKVAKEHSDMLEAVQAFSM
# GPRNCIGRNLAMTEMRLILAKILYNFDMKLANGSHSWIERQKNYNVKLLSKNSIAKFYMGTVPVYLISGTKHIQSIFGRDNKVGSEEIFTQAVLPTLY
# KMPKSHVERFANDKSGRGHVPAPGTEGTPKEQRYWARYEQIHTEYLARTQHLKPIIQAYSNQLAHDLNKYPLEKWTTLGVVETCRREVTKCAMSTLLG
# PKVFELDPDFLDTFWEFDHNVFMLTLGFPKWLNPGPYNAQDKYLSTIERYVHAAWDNFDWNGPDAESSWEPHFGARVCREIAKWFKESGFPDVSISGA
# LGTLLFAQNSNTIPTTMWMILRIFQDSCLLQAVREEVATTYSIDPVTGEHICDIQKLVVLPLLQSVFTEVLRLHMNFNIIRHAKENITMDGYNIRKGA
# MLQVPMMAAHYEESVWGSSGHPASEFWAERHIKYVEDTKEDGKTERRRVFAMAGRPSSYFPFGGGPPVCPGRHFAKHEILTTIGMLVSKFDIEVVKWV
# KLDGSPSDRPAQNNQTYCGAGTMPPDREMKIRIKRLCTWASFRPPKPEFTEKNVPSLEGKVYLVTGSNTGVGKETARILYSKGAKVWMAARSTEKASV
# AIDEIRNSQPSSTGSLHFLHLDLSDLSTVKQSAELFLSQEQTLHVLFNNAGVMVGTPEATNTVQGHELALGVNCIGTHLFTRLVTALLAKTAKSEPEG
# SVRVIWLSSFGLELFGAENVGVALDNLDYHEPKPATERYGISKCGAWALGVEYARRHKADGIVSVPINPGNLTSELARDQPAALKAIVKVVGYPPIMG
# AYTELFAALSPEITLEKSGEWVAPFGRFYPLRPDLINATKLESEGGTGGAYKFWEWTEQQIKDYI]
42	AUGUSTUS	transcript	9547	11216	0.06	-	.	g3.t2
42	AUGUSTUS	stop_codon	9547	9549	.	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	terminal	9547	9709	0.41	-	1	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	internal	9787	9962	0.85	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	internal	10051	10353	0.65	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	internal	10496	10522	0.33	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	initial	10581	11216	0.33	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	intron	9710	9786	0.82	-	.	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	intron	9963	10050	0.97	-	.	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	intron	10354	10495	0.44	-	.	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	intron	10523	10580	0.33	-	.	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	CDS	9550	9709	0.41	-	1	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	CDS	9787	9962	0.85	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	CDS	10051	10353	0.65	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	CDS	10496	10522	0.33	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	CDS	10581	11216	0.33	-	0	transcript_id "g3.t2"; gene_id "g3";
42	AUGUSTUS	start_codon	11214	11216	.	-	0	transcript_id "g3.t2"; gene_id "g3";
# coding sequence = [atgtatgggccggttgtgcgcattgcgcccaaccacctctcattcaccgatccacgggcatggaaggatatttattacc
# accgtgttggggctgtaggtggtatggtggaaatggccaagtctaccgagttcacgcgaaatgtcaaaggccaacttaccaccattgttaatgccgac
# caagacgaacatcaacaactgagacgagcgctttctcatggcttctcggacagctccatgagacagcaagaacccaccatgctcaaacacataaacat
# gctagtggatagactacgaacggagtctggcaaaaatccggatatggcggcatggtataactggacaacctttgacctctcgagtgatctgatttttg
# gagagtcgttccattgtcttcaaacagtcaattatcacccatgggttgctactatcatgaaggctatcaagtttcatgcgttcatggtagctctaggt
# tatggcggtgctaggccgctggtcgaattgatccacaaagccggtggatttctcgcgatgaaaacaatgcgcggttatatcgatagtatgctaaagtc
# aaggctggcaatgaagcaaaggcatgatgacctttttgaaggtttggctaaaagacgagatgaatggtctccattctttaggggctatcttttggata
# aactcagcgtgaatgccactgtcctactcctagctggctccgaaaccactgcaacttgtctatctggcacaacctatttccttctgacgcatccagag
# gtcttggagaaggtgaccgcggagatcagatctgccttctcaacagacgcggatataaatattcaatcagtaaacaaattgacatacttgattcctgt
# attaaacgaatctttgcgaatgtacccacctttgacctctggaatggtgcgagaagtccctacaggaggtgctgagatcgcagggcgattcgttcccg
# gtgataccctagttgagatccaacattggtcgataaatcacagcaaggagaactgggtcgacccttggtcgtttcgccctgaacgttttatggtggat
# gtcaaagtagccaaggaacacagtgatatgttggaagccgttcaagcatttagcatgggaccgcggaattgcatcggaagaaatcttgcaatgacgga
# aatgcgtcttatcttggctaagattctctataattttgatatgaaacttgcgaatggcagccatagctggatcgagaggcagaagaattacaacgtgt
# gggatcggataccattgaatgtgactttaacgcccgtcgaagtgaaatag]
# protein sequence = [MYGPVVRIAPNHLSFTDPRAWKDIYYHRVGAVGGMVEMAKSTEFTRNVKGQLTTIVNADQDEHQQLRRALSHGFSDSS
# MRQQEPTMLKHINMLVDRLRTESGKNPDMAAWYNWTTFDLSSDLIFGESFHCLQTVNYHPWVATIMKAIKFHAFMVALGYGGARPLVELIHKAGGFLA
# MKTMRGYIDSMLKSRLAMKQRHDDLFEGLAKRRDEWSPFFRGYLLDKLSVNATVLLLAGSETTATCLSGTTYFLLTHPEVLEKVTAEIRSAFSTDADI
# NIQSVNKLTYLIPVLNESLRMYPPLTSGMVREVPTGGAEIAGRFVPGDTLVEIQHWSINHSKENWVDPWSFRPERFMVDVKVAKEHSDMLEAVQAFSM
# GPRNCIGRNLAMTEMRLILAKILYNFDMKLANGSHSWIERQKNYNVWDRIPLNVTLTPVEVK]
# end gene g3
###
# start gene g4
42	AUGUSTUS	gene	12697	14331	0.6	+	.	g4
42	AUGUSTUS	transcript	12697	14331	0.45	+	.	g4.t1
42	AUGUSTUS	start_codon	12697	12699	.	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	initial	12697	13413	0.76	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	internal	13522	13836	0.92	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	internal	13929	14095	0.6	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	terminal	14175	14331	0.7	+	1	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	intron	13414	13521	0.78	+	.	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	intron	13837	13928	0.8	+	.	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	intron	14096	14174	0.69	+	.	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	CDS	12697	13413	0.76	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	CDS	13522	13836	0.92	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	CDS	13929	14095	0.6	+	0	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	CDS	14175	14328	0.7	+	1	transcript_id "g4.t1"; gene_id "g4";
42	AUGUSTUS	stop_codon	14329	14331	.	+	0	transcript_id "g4.t1"; gene_id "g4";
# coding sequence = [atgaacaaaggaacacttgctttcgacgtgcttcctatgcataagaagtacggtcccgttgttcgaattgcgcctaacg
# aactctcctttcaaactccccaggcatggaaagatatttatggtcatcggaccggcaccgctgccggagctgaggaaatggacaagtatcatacattc
# taccgtaccaagggagaggttctcagcatcagctcaggaggtcgcgagtatcatggaattcttcgtcgtcaattagcatacggattcagcgaccgcgc
# catgcgcgagcaggagcctatcattggcagttacattgatttgctgatcaagagactccatgaaaactgcgttgatcccaacgtgaaggatcccaaga
# caggaaacccagcggagaaaatgctaaacatggtctcctggtacaattggaccacatttgatgtgattggtgatttggtctttggcgagtcctttgga
# tcgcttgaaaatggaaactatgacccttgggtagccgctatcaatgactctatcaaattccttggtgttatcaatggagtcaagcatatgggtcttga
# atctctgttcatttgggttgttaaaaaacttaataccggccgccgtgagcacacagatcgattggtcaagaagcttcagaaacgtatcaatctcggcg
# ttgagcgtttagacttgatcgaaggcttgctacagaagaaagatgaatggaacctatctattcaccaccttgaagccaacggaagtagcatcttgatt
# gccggttcagaaacaacagctacaatgttgagtggtgttacctatatgctccttacacacccagaggccctccgcaaagttaccaaagaagtgcgcac
# cactttcaagtccagcgaagagatcacattgacatctgtcagttctcttacgtatatgcttgcctgcttgaatgagtcactgcgtgcttaccctcctg
# tcccttttggcatgcctcgccaggttccaaagggcggagccaccattgccggagaatatgtcccagaagacaccgtcgtcgctatttggcactgggct
# gcctaccataacgaccagctatggaccgatccattcggctatcatccagagcgctatctccacgatcccagatttgctaatgatgcttttgcaatcca
# caatccattctcccacgggcccagaaattgcattggaagacatttggcatacgcagaaatgagacttgtattggcgcgcctccttttcgattttgaga
# tgcgtttggcagatcctgacttagactggttgaaccacaaatcttatgtgctgtggtcgaagccagctttgaacgtatatttgactcctcgtgaattt
# taa]
# protein sequence = [MNKGTLAFDVLPMHKKYGPVVRIAPNELSFQTPQAWKDIYGHRTGTAAGAEEMDKYHTFYRTKGEVLSISSGGREYHG
# ILRRQLAYGFSDRAMREQEPIIGSYIDLLIKRLHENCVDPNVKDPKTGNPAEKMLNMVSWYNWTTFDVIGDLVFGESFGSLENGNYDPWVAAINDSIK
# FLGVINGVKHMGLESLFIWVVKKLNTGRREHTDRLVKKLQKRINLGVERLDLIEGLLQKKDEWNLSIHHLEANGSSILIAGSETTATMLSGVTYMLLT
# HPEALRKVTKEVRTTFKSSEEITLTSVSSLTYMLACLNESLRAYPPVPFGMPRQVPKGGATIAGEYVPEDTVVAIWHWAAYHNDQLWTDPFGYHPERY
# LHDPRFANDAFAIHNPFSHGPRNCIGRHLAYAEMRLVLARLLFDFEMRLADPDLDWLNHKSYVLWSKPALNVYLTPREF]
42	AUGUSTUS	transcript	12697	14099	0.15	+	.	g4.t2
42	AUGUSTUS	start_codon	12697	12699	.	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	initial	12697	13413	0.76	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	internal	13522	13836	0.92	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	terminal	13929	14099	0.2	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	intron	13414	13521	0.78	+	.	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	intron	13837	13928	0.8	+	.	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	CDS	12697	13413	0.76	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	CDS	13522	13836	0.92	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	CDS	13929	14096	0.2	+	0	transcript_id "g4.t2"; gene_id "g4";
42	AUGUSTUS	stop_codon	14097	14099	.	+	0	transcript_id "g4.t2"; gene_id "g4";
# coding sequence = [atgaacaaaggaacacttgctttcgacgtgcttcctatgcataagaagtacggtcccgttgttcgaattgcgcctaacg
# aactctcctttcaaactccccaggcatggaaagatatttatggtcatcggaccggcaccgctgccggagctgaggaaatggacaagtatcatacattc
# taccgtaccaagggagaggttctcagcatcagctcaggaggtcgcgagtatcatggaattcttcgtcgtcaattagcatacggattcagcgaccgcgc
# catgcgcgagcaggagcctatcattggcagttacattgatttgctgatcaagagactccatgaaaactgcgttgatcccaacgtgaaggatcccaaga
# caggaaacccagcggagaaaatgctaaacatggtctcctggtacaattggaccacatttgatgtgattggtgatttggtctttggcgagtcctttgga
# tcgcttgaaaatggaaactatgacccttgggtagccgctatcaatgactctatcaaattccttggtgttatcaatggagtcaagcatatgggtcttga
# atctctgttcatttgggttgttaaaaaacttaataccggccgccgtgagcacacagatcgattggtcaagaagcttcagaaacgtatcaatctcggcg
# ttgagcgtttagacttgatcgaaggcttgctacagaagaaagatgaatggaacctatctattcaccaccttgaagccaacggaagtagcatcttgatt
# gccggttcagaaacaacagctacaatgttgagtggtgttacctatatgctccttacacacccagaggccctccgcaaagttaccaaagaagtgcgcac
# cactttcaagtccagcgaagagatcacattgacatctgtcagttctcttacgtatatgcttgcctgcttgaatgagtcactgcgtgcttaccctcctg
# tcccttttggcatgcctcgccaggttccaaagggcggagccaccattgccggagaatatgtcccagaagacaccgtcgtcgctatttggcactgggct
# gcctaccataacgaccagctatggaccgatccattcggctatcatccagagcgctatctccacgatcccagatttgctaatgatgcttttgcaatcca
# caatccattctcccacgggcccagaaattgcattggaagacagtaa]
# protein sequence = [MNKGTLAFDVLPMHKKYGPVVRIAPNELSFQTPQAWKDIYGHRTGTAAGAEEMDKYHTFYRTKGEVLSISSGGREYHG
# ILRRQLAYGFSDRAMREQEPIIGSYIDLLIKRLHENCVDPNVKDPKTGNPAEKMLNMVSWYNWTTFDVIGDLVFGESFGSLENGNYDPWVAAINDSIK
# FLGVINGVKHMGLESLFIWVVKKLNTGRREHTDRLVKKLQKRINLGVERLDLIEGLLQKKDEWNLSIHHLEANGSSILIAGSETTATMLSGVTYMLLT
# HPEALRKVTKEVRTTFKSSEEITLTSVSSLTYMLACLNESLRAYPPVPFGMPRQVPKGGATIAGEYVPEDTVVAIWHWAAYHNDQLWTDPFGYHPERY
# LHDPRFANDAFAIHNPFSHGPRNCIGRQ]
# end gene g4
###
# start gene g5
42	AUGUSTUS	gene	15265	16021	0.98	-	.	g5
42	AUGUSTUS	transcript	15265	16021	0.98	-	.	g5.t1
42	AUGUSTUS	stop_codon	15265	15267	.	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	terminal	15265	15708	0.98	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	internal	15771	15830	1	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	internal	15898	15921	1	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	initial	15986	16021	1	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	intron	15709	15770	1	-	.	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	intron	15831	15897	1	-	.	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	intron	15922	15985	1	-	.	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	CDS	15268	15708	0.98	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	CDS	15771	15830	1	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	CDS	15898	15921	1	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	CDS	15986	16021	1	-	0	transcript_id "g5.t1"; gene_id "g5";
42	AUGUSTUS	start_codon	16019	16021	.	-	0	transcript_id "g5.t1"; gene_id "g5";
# coding sequence = [atgatgactttggatcttgagagacaactcgtcttttatggcacttaccaccataatccggtcaatgtccggatacaca
# tgatcttcgttcccgtcatcctcataaccagtattcaattgttcaccaacacaccaacgctcatccccctgccggactttcttcaatacaaatacctc
# cctctcaacgccggcacaatccaatccctaatctacgccctgggctacatcctcctcgagccggtcgtcggtctgatatgcgttcctactctgctggg
# tgccgccgcctacatgaattacctcacaatgacctacggcgcgactgctacatcctggtccttcggaatctttatcgtgtcatggattgctcagttta
# ttggccatggagcctacgagggacgatcgccggctttgttggataatcttttccaggcgctgtttttggcgccgttgtttgtgtttttggagtatttg
# tttatgtttgggtatcggccggagttgcagcggagggtcgaggcggaggtgcagaagaagcttgcgcagttgaacacgccgaagaacaagtga]
# protein sequence = [MMTLDLERQLVFYGTYHHNPVNVRIHMIFVPVILITSIQLFTNTPTLIPLPDFLQYKYLPLNAGTIQSLIYALGYILL
# EPVVGLICVPTLLGAAAYMNYLTMTYGATATSWSFGIFIVSWIAQFIGHGAYEGRSPALLDNLFQALFLAPLFVFLEYLFMFGYRPELQRRVEAEVQK
# KLAQLNTPKNK]
# end gene g5
###
# start gene g6
42	AUGUSTUS	gene	17133	17881	0.88	+	.	g6
42	AUGUSTUS	transcript	17133	17754	0.6	+	.	g6.t1
42	AUGUSTUS	start_codon	17133	17135	.	+	0	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	initial	17133	17381	1	+	0	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	internal	17440	17690	0.96	+	0	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	terminal	17745	17754	0.6	+	1	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	intron	17382	17439	1	+	.	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	intron	17691	17744	0.6	+	.	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	CDS	17133	17381	1	+	0	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	CDS	17440	17690	0.96	+	0	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	CDS	17745	17751	0.6	+	1	transcript_id "g6.t1"; gene_id "g6";
42	AUGUSTUS	stop_codon	17752	17754	.	+	0	transcript_id "g6.t1"; gene_id "g6";
# coding sequence = [atgttcttcctcaaagaggaaaccaaagtcgtcaccctccacccgtcctttttcggacccaatgtcaaggaatatctga
# tcaaccgcttgaacgaagaagaagagggacgatgtacgggtgatcatttcgtgatttgtgtcatggacatggtggatattggcgacgggcgagtgata
# ccgggcagtggacatgcagaatatactatcaaatatcgcgcgatcatatggaagcctttccgaggggagacggtcgatgccatcgtgacctcggttaa
# acccaccggtatcttcacgctcgcgggccctctgtcggtgtttattgcgcgcaaaaatataccatcagatatcaaatgggaacccggcaccgtgccgc
# cccaatatacggatcatgcagaccaggttattgagcgaggaacgagtctgcggttgaagatactgggtgtgaagccagatgtgtctgcgattaatgcg
# attggcaccattaaggaggattatcttggcaccctctaa]
# protein sequence = [MFFLKEETKVVTLHPSFFGPNVKEYLINRLNEEEEGRCTGDHFVICVMDMVDIGDGRVIPGSGHAEYTIKYRAIIWKP
# FRGETVDAIVTSVKPTGIFTLAGPLSVFIARKNIPSDIKWEPGTVPPQYTDHADQVIERGTSLRLKILGVKPDVSAINAIGTIKEDYLGTL]
42	AUGUSTUS	transcript	17133	17881	0.28	+	.	g6.t2
42	AUGUSTUS	start_codon	17133	17135	.	+	0	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	initial	17133	17381	1	+	0	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	internal	17440	17690	0.96	+	0	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	terminal	17734	17881	0.28	+	1	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	intron	17382	17439	1	+	.	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	intron	17691	17733	0.28	+	.	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	CDS	17133	17381	1	+	0	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	CDS	17440	17690	0.96	+	0	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	CDS	17734	17878	0.28	+	1	transcript_id "g6.t2"; gene_id "g6";
42	AUGUSTUS	stop_codon	17879	17881	.	+	0	transcript_id "g6.t2"; gene_id "g6";
# coding sequence = [atgttcttcctcaaagaggaaaccaaagtcgtcaccctccacccgtcctttttcggacccaatgtcaaggaatatctga
# tcaaccgcttgaacgaagaagaagagggacgatgtacgggtgatcatttcgtgatttgtgtcatggacatggtggatattggcgacgggcgagtgata
# ccgggcagtggacatgcagaatatactatcaaatatcgcgcgatcatatggaagcctttccgaggggagacggtcgatgccatcgtgacctcggttaa
# acccaccggtatcttcacgctcgcgggccctctgtcggtgtttattgcgcgcaaaaatataccatcagatatcaaatgggaacccggcaccgtgccgc
# …